SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014074 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014074
Domain Number 1 Region: 70-240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.67e-31
Family Laminin G-like module 0.057
Further Details:      
 
Domain Number 2 Region: 2-52
Classification Level Classification E-value
Superfamily vWA-like 0.00000000371
Family Integrin A (or I) domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014074   Gene: ENSTGUG00000013673   Transcript: ENSTGUT00000014235
Sequence length 243
Comment pep:novel chromosome:taeGut3.2.4:Un:86621989:86627558:1 gene:ENSTGUG00000013673 transcript:ENSTGUT00000014235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGFTFFAIGVADADYSELVNIGSKPSERHVFFVDDFDAFTKIEDELITFVCETASAITVK
EYYDLFKSHGFKMMEMFGLVEKEFSAVEGVSMEPGTFNVFPCYRLHKDALVSQPTKYLHP
EGLPSDYTITFLFRILPDTPQEPFALWEILNEAYEPLVGVILDNGGKTLTFFNYDYKGDF
QTVTFEGPEIRKIFYGSFHKLHVVISKTTAKIIIDCKEVGEKTINAAGNISSDGIEVLGR
MVR
Download sequence
Identical sequences H0ZTX7
ENSTGUP00000014074 ENSTGUP00000014074 59729.ENSTGUP00000014074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]