SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014130 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000014130
Domain Number - Region: 1-40
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0142
Family Chromo domain 0.0093
Further Details:      
 
Domain Number - Region: 170-196
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0474
Family Fibronectin type III 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014130   Gene: ENSTGUG00000013730   Transcript: ENSTGUT00000014294
Sequence length 210
Comment pep:novel chromosome:taeGut3.2.4:Un:171690773:171694009:1 gene:ENSTGUG00000013730 transcript:ENSTGUT00000014294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYSTWEPEDHILDPRLVVAYEEKEERDRASGYRKRGPKPKRLLLQRLYGMDLRSAHKGKE
KLCFSLARRFGGGDSSLPGAKTGQAEFPEKTGGAVLPFSLRKQRKNQKYLRLSRKKFPRM
ASLENRNCRHEFFLNDAVGLEARQSPEDWEAMQHTSKEGKAKMKQGCLPWIPTVPPSEVT
VTDITANSITVTFREAQVAEGFFRDRSAQF
Download sequence
Identical sequences H0ZU33
ENSTGUP00000014130 59729.ENSTGUP00000014130 ENSTGUP00000014130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]