SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014247 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014247
Domain Number 1 Region: 2-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000455
Family EGF-type module 0.019
Further Details:      
 
Domain Number 2 Region: 29-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000414
Family EGF-type module 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014247   Gene: ENSTGUG00000013848   Transcript: ENSTGUT00000014414
Sequence length 120
Comment pep:novel chromosome:taeGut3.2.4:28_random:12342:13005:1 gene:ENSTGUG00000013848 transcript:ENSTGUT00000014414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSAFCYNTLSSFKCVCPSGFDFDQAFGGCQDVDECSAGGSPCSYGCSNTDGGYLCGCPGG
YFRAGQGHCISGLGFGKGPYLPAPQEEDEDNLLSPETCYECKINGYPKRGRQRRSVNGTE
Download sequence
Identical sequences H0ZUF0
ENSTGUP00000014247 59729.ENSTGUP00000014247 ENSTGUP00000014247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]