SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014278 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014278
Domain Number 1 Region: 698-865
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-80
Family Thrombospondin C-terminal domain 0.000000441
Further Details:      
 
Domain Number 2 Region: 571-696
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.85e-34
Family TSP type-3 repeat 0.00000459
Further Details:      
 
Domain Number 3 Region: 489-573
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.54e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 199-244
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000126
Family Assembly domain of cartilage oligomeric matrix protein 0.0016
Further Details:      
 
Domain Number 5 Region: 421-514
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000248
Family TSP type-3 repeat 0.00018
Further Details:      
 
Domain Number 6 Region: 28-126
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000369
Family Laminin G-like module 0.0097
Further Details:      
 
Domain Number 7 Region: 290-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000288
Family EGF-type module 0.024
Further Details:      
 
Domain Number 8 Region: 337-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000524
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000014278
Domain Number - Region: 397-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00146
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014278   Gene: ENSTGUG00000013839   Transcript: ENSTGUT00000014447
Sequence length 865
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:87777152:87782258:-1 gene:ENSTGUG00000013839 transcript:ENSTGUT00000014447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIDLLLVSEARQMASVAHKIRMELLTVNDVYLLSTFRLPPKQGGTLFGLYSKKDNTRWLE
VSVVGKINKVLVRYLREDNKVHSVNLQHAQVADGQSHSVIVRLSGLRRDTLSVELYVDCK
QMDSSVGLPELSEIPLAEVESIEVRTGLKAYQRMQGFVESMKLILGGSMSRVGALSECPF
QGDESIHGAVTSVLASILGEQTKALVTQLTLFNQVLTDLREDIRDQVKEMSLIRNTIMEC
QVCGFHEHRSRCNPNPCFSGVDCMETYEYPGYRCGPCPPGLEGNGTHCADIEECAHANPC
FPGSKCINTSPGFRCEPCPRGYRGNTVSGVGVDYAKASKQVCTDIDECNDGNNGGCDPNS
ICTNTLGSYKCGPCKSGFVGNQTSGCVPQRSCSTATSNPCDINGFCLFERNGEISCACNV
GWAGNGNVCGPDTDLDGYPDEPLPCIDNNKHCKQDNCRLTPNSGQEDADNDGIGDQCDDD
ADGDGVKNVEDNCRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQRDTDSNGEGDACDNDI
DGDGIPNMLDNCPKVPNPLQTDRDEDGVGDACDSCPEMSNPTQTDMDSDLVGDICDTNED
SDGDGHQDTKDNCAEIPNSSQLDSDNDGLGDDCDNDDDNDGIPDYVAPGPDNCRLIPNPN
QKDSDGNGVGDVCEEDFDNDTVVDQLDVCPESAEVTLTDFRAYQTVILDPEGDAQIDPNW
VVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTITDDDYAGFIFSYQDSASFYV
VMWKQTEQTYWQATPFRAVAEPGLQLKAVKSSTGPGEHLRNALWHTGHTPDHVRLLWKDP
RNVGWRDKTSYRWQLAHRPQVGYIR
Download sequence
Identical sequences H0ZUI1
ENSTGUP00000014278 59729.ENSTGUP00000014278 ENSTGUP00000014278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]