SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014298 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014298
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000138
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000014298
Domain Number - Region: 65-96
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000187
Family Complement control module/SCR domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014298   Gene: ENSTGUG00000013898   Transcript: ENSTGUT00000014469
Sequence length 96
Comment pep:novel chromosome:taeGut3.2.4:Un:117163479:117164000:-1 gene:ENSTGUG00000013898 transcript:ENSTGUT00000014469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGAPPNLTFAELTREYKNQLEFAVGDTVHYSCRPGHSRRHGVPPTLTCLQNHTWSEALEF
CKRKQCRHPEPPRNGRVVVLTDLLFGSTVNHTCDEG
Download sequence
Identical sequences H0ZUK1
59729.ENSTGUP00000014298 ENSTGUP00000014298 ENSTGUP00000014298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]