SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014311 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014311
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.79e-41
Family Bee venom hyaluronidase 0.00083
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000014311
Domain Number - Region: 174-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0227
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014311   Gene: ENSTGUG00000013899   Transcript: ENSTGUT00000014484
Sequence length 189
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:87807605:87808410:1 gene:ENSTGUG00000013899 transcript:ENSTGUT00000014484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YTGQCQPAEVQRNNHLGWLWAASSALYPSIYLPPALPPALRRRYVHHRLREALRVAAFGP
DGLLPVIAYSRLAFRRSSRFLQLADLVHTIGESAALGAAGLVLWGDMSYSRSAESCASLR
HYLVSTLGPYVANVTAAARECSYGQCHGHGRCVRRQPHDLGSLLHLGPGASPQAAFRCHC
YRGWAGENC
Download sequence
Identical sequences H0ZUL4
59729.ENSTGUP00000014311 ENSTGUP00000014311 ENSTGUP00000014311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]