SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014345 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014345
Domain Number 1 Region: 5-121,154-268,369-432
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.09e-17
Family Glycerol-3-phosphate transporter 0.067
Further Details:      
 
Domain Number 2 Region: 288-339
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000513
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014345   Gene: ENSTGUG00000013934   Transcript: ENSTGUT00000014522
Sequence length 455
Comment pep:novel chromosome:taeGut3.2.4:Un:60452917:60459522:1 gene:ENSTGUG00000013934 transcript:ENSTGUT00000014522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSYMWVYILLGSMLRGIGETPITPLGISYLDDFTKEENVPVYVAFLHTIAMMGPMFGFLL
GSLCAKLYVDIGFVDPEFPINSCICLHYINYSNICYLLDPYFCLLLRIPSCISTLVFSRT
RFCFQMPSCKGRSDLAPIFAVIMPCIFQCQLICPFLSDFYNSLKKVLGNRMYFTFLCCSL
LQFSSFIGFVTYKPKYMEQQYGQSTSKSNFLIGVTSLPPVGLGIFLGGLIMKKYKMGIVA
ATKFSLTMSFLSYAIGLLHFFVGCDNHAVAGMTVSYEGNPILYHNNSLFSECNSHCKCAS
NVWDPVCGANGITYFSACLAGCGTSVGHGKNTVFHNCRCLEINSSWTGNNSATLGQCPKS
DDCSTKFIYYTVIQVIGGFCYALGATPSYMLVFRCVQPELKALAVGLFTLVMRTLAGIPA
PVYFGAAIDKTCLKWGSTSCGKRGACKLYDSNAIR
Download sequence
Identical sequences H0ZUP8
ENSTGUP00000014345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]