SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014368 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000014368
Domain Number - Region: 2-49
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0015
Family SPRY domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014368   Gene: ENSTGUG00000013972   Transcript: ENSTGUT00000014546
Sequence length 107
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:88355427:88356475:-1 gene:ENSTGUG00000013972 transcript:ENSTGUT00000014546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDYPKNRHPGWSRGSVAYHADDGKLFHGSGVGDPFGPRCYKGDVMGCGIMFPRDYGRDSE
GDSDDASEPPEVKVHNVMYLEEEEEEEEEEEEEDGEDMEQEGRKVLV
Download sequence
Identical sequences H0ZUS1
ENSTGUP00000014368 ENSTGUP00000014368 59729.ENSTGUP00000014368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]