SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014451 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014451
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-21
Family YWTD domain 0.00046
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000014451
Domain Number - Region: 145-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000223
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014451   Gene: ENSTGUG00000014062   Transcript: ENSTGUT00000014635
Sequence length 179
Comment pep:novel chromosome:taeGut3.2.4:Un:89480313:89485444:-1 gene:ENSTGUG00000014062 transcript:ENSTGUT00000014635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLFFTDYGNAAKVERCDMDGTNRTWIVDSKIEQPTALALDLINKYVYWLDIYLETVEVVD
YQGRRRQTITKGRQIRHLSGLAVFENYLYTINSDNLSILRIDRYNGTDVQALARLDNAKE
IRVYQKRTQAAARSHACEPDPSGTPGGCSHICLLGSSHKARTCRCRTGFILATDGRSCK
Download sequence
Identical sequences H0ZV04
XP_012431663.1.42559 ENSTGUP00000014451 ENSTGUP00000014451 59729.ENSTGUP00000014451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]