SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014472 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014472
Domain Number 1 Region: 161-266
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.35e-40
Family Transforming growth factor (TGF)-beta 0.0000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014472   Gene: ENSTGUG00000014084   Transcript: ENSTGUT00000014657
Sequence length 266
Comment pep:novel chromosome:taeGut3.2.4:28_random:184528:185325:1 gene:ENSTGUG00000014084 transcript:ENSTGUT00000014657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGRFLPEGQPQGRLCLRKLLFFNLSALQEGERLTMAQLELQFHHNSYHWPSPGQVLELRL
YRASPRGLPRPGRSPLVERSFVQLRKSLLLDLSAALKDGTAPGRNLALVLEISASGDGGT
VRGPCAGSDAFAATSLLLVTLGPRCRAARSRRSAPSPPLTPSPLCKPRRLYISFSDVGWE
NWIIAPQGYLANYCGGECPFPLAAELNSTNHAVLQTMVHSLDPQGTPQPCCVPVRLSPIS
ILYYDNSDNVVLRHYEDMVVDECGCR
Download sequence
Identical sequences H0ZV25
ENSTGUP00000014472 59729.ENSTGUP00000014472 ENSTGUP00000014472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]