SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014507 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014507
Domain Number 1 Region: 150-255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-49
Family Thrombospondin C-terminal domain 0.0000168
Further Details:      
 
Domain Number 2 Region: 36-148
Classification Level Classification E-value
Superfamily TSP type-3 repeat 8.5e-29
Family TSP type-3 repeat 0.00000744
Further Details:      
 
Domain Number 3 Region: 1-35
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000144
Family TSP type-3 repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014507   Gene: ENSTGUG00000014102   Transcript: ENSTGUT00000014693
Sequence length 255
Comment pep:known_by_projection chromosome:taeGut3.2.4:28_random:195140:197440:1 gene:ENSTGUG00000014102 transcript:ENSTGUT00000014693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNCMTVPNSGQEDADRDGIGDACDDDADGDGIPNAEKDTDHDLVGDVCDTNQDSDGDGHQ
DSRDNCPTVPNSSQLDTDGDGLGDECDEDDDDDGVPDFRPPGPDNCRLVPNPTQDSDGDG
VGNLCEDDFDRDMVIDRIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWIVLNQGME
IVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDYAGFIFGYQDSSSFYVVMWKQMEQ
TYWQANPFRAVAEPG
Download sequence
Identical sequences H0ZV60
59729.ENSTGUP00000014507 ENSTGUP00000014507 ENSTGUP00000014507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]