SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014546 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014546
Domain Number 1 Region: 237-419
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-53
Family SPRY domain 0.0000358
Further Details:      
 
Domain Number 2 Region: 61-121
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000839
Family B-box zinc-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000182
Family RING finger domain, C3HC4 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014546   Gene: ENSTGUG00000014157   Transcript: ENSTGUT00000014733
Sequence length 423
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:32192269:32196452:1 gene:ENSTGUG00000014157 transcript:ENSTGUT00000014733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHYFCRRCITEHWVRQEPQGTRDCPECRRTFPEPTLAPSLKLANIVERYSAFPLDAILGA
QRSPFPCKDHEKVKLFCLTDRAVVCFFCDEPAMHEQHQVTNVDDAFEELQRELKEQLQGL
QESERGHTEALQLLKKQLAETKVRVRTPLSPLGTPMIPQPPKAQLGSSSLPPHPDPHQPA
FGTSKLQTVQFHGFAQFFFFLWLKGKIHETNLTYEDFPTSKYMGPLQYTIWKSLFQDIHP
VPAALTLDPGTAHHRLILSDDCTIVAYGNLHPQPLQDSPRRFDVEVSVLGAEAFGAGVHY
WEVVVSEKTQWMIGLAHEAVTRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVKGK
LEKVGVFLDYDKGLLIFYNADDMSWLYTFRERFPGKLCSYFSPGQSHANGKNVQPLRINT
VRI
Download sequence
Identical sequences H0ZV99
ENSTGUP00000014546 59729.ENSTGUP00000014546 ENSTGUP00000014546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]