SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014566 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014566
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.56e-32
Family GABARAP-like 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014566   Gene: ENSTGUG00000014174   Transcript: ENSTGUT00000014756
Sequence length 87
Comment pep:novel chromosome:taeGut3.2.4:Un:61546746:61549298:1 gene:ENSTGUG00000014174 transcript:ENSTGUT00000014756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSAT
MGQLYEDNHEEDYFLYVAYSDESVYGK
Download sequence
Identical sequences A0A091F929 A0A091GVA1 A0A091IF70 A0A091LM28 A0A091MYQ3 A0A091W253 A0A093EQU0 A0A093FLH8 A0A093RX43 A0A094KNL3 A0A0A0A2Q6 G1P8T2 H0ZVB9 H2ZUA0
ENSLACP00000000971 ENSVPAP00000001935 ENSLACP00000000971 XP_002191690.1.42559 XP_009708400.1.71050 XP_009873414.1.31609 XP_009914556.1.2804 XP_009968517.1.75343 XP_009983073.1.11325 XP_010085657.1.40768 XP_010130171.1.100080 XP_010149052.1.22856 XP_010167037.1.30499 XP_010188174.1.17318 XP_010283204.1.48707 ENSTGUP00000014566 ENSTGUP00000014566 ENSVPAP00000001935 ENSMLUP00000006597 ENSMLUP00000006597 ENSMICP00000012370 59729.ENSTGUP00000014566 ENSMICP00000012370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]