SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014577 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014577
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-55
Family Eukaryotic proteases 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014577   Gene: ENSTGUG00000014193   Transcript: ENSTGUT00000014768
Sequence length 169
Comment pep:novel chromosome:taeGut3.2.4:Un:90794119:90796579:-1 gene:ENSTGUG00000014193 transcript:ENSTGUT00000014768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTRLVKTIILHPRYNRAVVDYDISIVELDEDINETSYVRPVCLPSKSQLVQPDTYCYIT
GWGHMGNKSKMKSISLQEGEVRIISLEQCQSYFDMKIITSRMLCAGYESGTVDSCMGDSG
GPLVCEHTAGRWTLFGLTSWGSVCFSKVLGPGVYSNVSHFIEWIERQIY
Download sequence
Identical sequences H0ZVD0
59729.ENSTGUP00000014577 ENSTGUP00000014577 ENSTGUP00000014577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]