SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014666 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014666
Domain Number 1 Region: 34-188
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-43
Family Eukaryotic proteases 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014666   Gene: ENSTGUG00000014285   Transcript: ENSTGUT00000014865
Sequence length 188
Comment pep:novel chromosome:taeGut3.2.4:Un:33357381:33359263:-1 gene:ENSTGUG00000014285 transcript:ENSTGUT00000014865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WERVNVSPCSGKELKATEETPTEPPTDPPEIFKTCGQPEVHRTLKKIYGGSKATPGKHPW
MASLQTRTPDGNKHFCGGVLIKSCWVLTAAHCLQEPKPNIQVVLGKQNLKKKEDHEQIFD
AVHIVLHGKYREEPGHALYNDIALLKLQPVDGYCAVETKHVKIACVPDFFLPAGTSCFIS
GWGSTETG
Download sequence
Identical sequences H0ZVL9
ENSTGUP00000014666 59729.ENSTGUP00000014666 ENSTGUP00000014666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]