SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014692 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014692
Domain Number 1 Region: 3-170
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.2e-56
Family Eukaryotic proteases 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014692   Gene: ENSTGUG00000014313   Transcript: ENSTGUT00000014895
Sequence length 170
Comment pep:novel chromosome:taeGut3.2.4:Un:92411842:92413052:-1 gene:ENSTGUG00000014313 transcript:ENSTGUT00000014895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEVRKIKKLHRHENYKRSDISNDIALLELNEPVQCSSYIQLACVAEPTLRVSELINCWIA
GWGATTEGDEDSSDHLQEAKVQLIDVQLCNSSDWYAGEVHPYNLCAGYPEGNIDTCQGDS
GGPLMCQDNNTDSRWVVGVTSWGRGCARAKLPGIYTSTQYFYDWILAQMG
Download sequence
Identical sequences H0ZVP5
ENSTGUP00000014692 59729.ENSTGUP00000014692 ENSTGUP00000014692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]