SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014716 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014716
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.57e-32
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0000134
Further Details:      
 
Domain Number 2 Region: 74-187
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.07e-29
Family UBX domain 0.0000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014716   Gene: ENSTGUG00000014336   Transcript: ENSTGUT00000014921
Sequence length 190
Comment pep:novel chromosome:taeGut3.2.4:2_random:998980:1002169:1 gene:ENSTGUG00000014336 transcript:ENSTGUT00000014921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQILLKLWRNGFSLDDGELRSYSDPTNAQFLESVKRGEIPLELQRLVHGGQVNLDMEDHQ
EQEYVKPRLRFKAFSGEGQKLGSLTPEIVSTPSSPEEEEKSILNAPVLIDDSMPATKIQI
RLADGSRLIQRFNQTHRIKHIRDFIIQSRPAFATTDFVLVTTFPNKELTDESLTLQEADI
LNTVILQQLK
Download sequence
Identical sequences H0ZVR8
ENSTGUP00000014716 59729.ENSTGUP00000014716 XP_002192491.1.42559 ENSTGUP00000014716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]