SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014765 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014765
Domain Number 1 Region: 73-137
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000051
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 305-396
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000484
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 3 Region: 14-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000128
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 
Domain Number 4 Region: 197-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000275
Family Spermadhesin, CUB domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014765   Gene: ENSTGUG00000014389   Transcript: ENSTGUT00000014970
Sequence length 397
Comment pep:novel chromosome:taeGut3.2.4:Un:93268972:93273609:-1 gene:ENSTGUG00000014389 transcript:ENSTGUT00000014970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQPVPKPESRVEVCDLNPCPPRWKVTPAGPCSSSCGLGLAVQLVTCVQTLHGQEVLQEEH
LCPVAEKPLTSVPCVIRTCSYEWSFSEWSECSTTCGNGIQTRQDFCLSSLTHKPVNPLFC
RRFPKAIVVRGCSVGPCPEQEGTQSPGAELQPVPPATHLPTAAPEHRHKDLDVPLSAGPW
EQTEPSGGEEGTVKRSFLCVCGNLFLNATGIINMTGVESRDCTVAIGRPLREEISVTILE
SSLNCSAGEVLLFSGRMMWRTGCRKLPLSLINSRTNTLIVKQRVVLPGNGVILQYNSRTA
TKKYYQDCDQQLFGPQGEIVAPVERQEGVCRTFITVAPRQRISIRALNTDLGPEGNQTEF
NYILVRDVSTMKTVVFRGKQQFLWQSTGNQAEIEFHE
Download sequence
Identical sequences H0ZVW7
ENSTGUP00000014767 59729.ENSTGUP00000014765 ENSTGUP00000014765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]