SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014767 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014767
Domain Number 1 Region: 56-120
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 288-378
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000222
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 3 Region: 4-62
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000249
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 
Domain Number 4 Region: 181-278
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000327
Family Spermadhesin, CUB domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014767   Gene: ENSTGUG00000014389   Transcript: ENSTGUT00000014973
Sequence length 378
Comment pep:novel chromosome:taeGut3.2.4:Un:93268978:93272755:-1 gene:ENSTGUG00000014389 transcript:ENSTGUT00000014973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCPVRWKVTPAGPCSSSCGLGLAVQLVTCVQTLHGQEVLQEEHLCPVAEKPLTSVPCVIR
TCSYEWSFSEWSECSTTCGNGIQTRQDFCLSSLTHKPVNPLFCRRFPKAIVVRGCSVGPC
PEQEGTHCSQCHQPHTCPQLPQSTDTRIWMSLCLLGPGSRQSPVEVRRAQSKGASCNMNL
TCVCGNLFLNATGIINMTGVESRDCTVAIGRPLREEISVTILESSLNCSAGEVLLFSGRM
MWRTGCRKLPLSLINSRTNTLIVKQRVVLPGNGVILQYNSRTATKKYYQDCDQQLFGPQG
EIVAPVERQEGVCRTFITVAPRQRISIRALNTDLGPEGNQTEFNYILVRDVSTMKTVVFR
GKQQFLWQSTGNQAEIEF
Download sequence
Identical sequences H0ZVW9
ENSTGUP00000014767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]