SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014801 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014801
Domain Number 1 Region: 65-137
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.39e-19
Family Complement control module/SCR domain 0.00063
Further Details:      
 
Domain Number 2 Region: 20-75
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000389
Family Complement control module/SCR domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014801   Gene: ENSTGUG00000014430   Transcript: ENSTGUT00000015009
Sequence length 137
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:121121142:121123021:1 gene:ENSTGUG00000014430 transcript:ENSTGUT00000015009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRAPARPGFAELKEPYRNQTVFPEGSRVELVCQPGYTQLPGVSAAITCLRNQTWSAALDF
CKRKQCPSPGNPANGRAVVLTDLLFESKINYTCDKGYKLVGGSQRICEVSGTHVSWSGDP
PVCQQVTCPAPPSIANG
Download sequence
Identical sequences H0ZW02
ENSTGUP00000014801 ENSTGUP00000014801 59729.ENSTGUP00000014801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]