SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014818 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014818
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.94e-24
Family Eukaryotic proteases 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014818   Gene: ENSTGUG00000014447   Transcript: ENSTGUT00000015028
Sequence length 56
Comment pep:novel chromosome:taeGut3.2.4:11_random:238155:239753:-1 gene:ENSTGUG00000014447 transcript:ENSTGUT00000015028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRDSCQGDSGGPLVCEGTLQGIVSWGMERCGTPRRPGVYTKVCRYARWIRDTMEDT
Download sequence
Identical sequences H0ZW19
ENSTGUP00000014818 59729.ENSTGUP00000014818 ENSTGUP00000014818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]