SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014864 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014864
Domain Number 1 Region: 51-162
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-27
Family DEP domain 0.00000477
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily PH domain-like 0.00000953
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014864   Gene: ENSTGUG00000014486   Transcript: ENSTGUT00000015076
Sequence length 188
Comment pep:novel chromosome:taeGut3.2.4:Un:147012518:147016368:1 gene:ENSTGUG00000014486 transcript:ENSTGUT00000015076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVFKLTVAKQQDHFFQAAYLEERDAWVRDIKKAIHHIDGGQRFARKSTRKSIRLPETINL
SALYLSMKDPEKGIKALKLEKDKRVFNHCFTGTCVIDWLVSSSSVRNRKEGLLLASSLLS
EGYLQPAGDTSKAAAEGLSDTPFLDLSDAYYYFPDSGFFCEGYSSDDDVVLKEEFRGTIV
KQGCLLKQ
Download sequence
Identical sequences H0ZW65
59729.ENSTGUP00000014864 XP_002196590.1.42559 ENSTGUP00000014864 ENSTGUP00000014864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]