SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014923 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014923
Domain Number 1 Region: 235-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000176
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 2 Region: 322-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 3 Region: 358-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 4 Region: 410-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000014923
Domain Number - Region: 16-71
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0482
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014923   Gene: ENSTGUG00000014544   Transcript: ENSTGUT00000015141
Sequence length 551
Comment pep:novel chromosome:taeGut3.2.4:12_random:278444:281695:1 gene:ENSTGUG00000014544 transcript:ENSTGUT00000015141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IENVVTSFAPRPKKAWWQSENGVEHVSIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSAD
FGQTWKVYRYFYDCAASFPHVPHGPPRRIDDVVCESRYSDIEPSTEGEVIYRVLDPAIPI
RDPYSPSIQSDGLITHPRLNLDWEQEGRNLQGRATGKLQFWESHPVLCQGSCLCCGNAEP
SPRTARLCTATCVGAEPPQLRTAQPGHMQPRACEPNHAQPWAKTVSCEPPTASCCDCNEH
SRRCHFDMAVYLATGNTSGAVCDGCQHNTMGRRCHLCKPFYYKDPTKDLRDPAVCRACDC
DPEGSLDGGLCDSADDPARGLIAGQCRCKEHVAGPRCDRCKPGFFGLSTDNPQGCRRCQC
DPRGTVADGSRCDPVSGECFCKRLVAGRSCSQCLPEHWGLSHDLQGCRPCDCDVGGARNN
LCAMGTGQCQCRSHVIGRQCEQVEAGFYRINLDHYTYEAEDARLHQGSVVEREPPPDRPA
SWTGTGFARMLEGGWVEFHVNDVPFSTEYDVVIRYEPQHPEAWQEVKLKVLRPSPVSSSP
CGNTIPADDKL
Download sequence
Identical sequences H0ZWC4
ENSTGUP00000014923 59729.ENSTGUP00000014923 ENSTGUP00000014923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]