SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014938 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014938
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.89e-42
Family Glutathione peroxidase-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014938   Gene: ENSTGUG00000014571   Transcript: ENSTGUT00000015159
Sequence length 142
Comment pep:novel chromosome:taeGut3.2.4:Un:147908312:147910761:1 gene:ENSTGUG00000014571 transcript:ENSTGUT00000015159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSLVVNVASECGYTDSHYKALQQLQRDLGPYHFNVLAFPCNQFGQQEPDTNKEIESFAR
KTYGASFPMFSKITVSGAGAIPAFKYLIDSTGEEPTWNFWKYLVDPNGKVVKAWDSTVSV
EEIRPHVTELVRKIILKKKDEL
Download sequence
Identical sequences H0ZWD8
59729.ENSTGUP00000014938 ENSTGUP00000014938 ENSTGUP00000014938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]