SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014972 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014972
Domain Number 1 Region: 163-261
Classification Level Classification E-value
Superfamily vWA-like 4.13e-24
Family Integrin A (or I) domain 0.0048
Further Details:      
 
Domain Number 2 Region: 38-159
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.28e-18
Family Growth factor receptor domain 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000014972
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily vWA-like 0.000222
Family Integrin A (or I) domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014972   Gene: ENSTGUG00000014602   Transcript: ENSTGUT00000015198
Sequence length 261
Comment pep:novel chromosome:taeGut3.2.4:Un:95531519:95533795:-1 gene:ENSTGUG00000014602 transcript:ENSTGUT00000015198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLRAMASPPLEEHVFLVESFELIQQFAKQFQDKLCGVDMCVGREHGCQHSCVSTPGSFYC
ECNPGYRLNVDGKTCSPVDACADGSHGCQHHCVSTRGSYSCRCRPGYYLSHNKRSCTMID
YCSFGNHSCQHECVSIPNGHYCRCRSGFTLQPDSKSCRATDLCNGVDHGCEFKCVSTEGS
YHCVCPEGQQLQADGKTCSKCGAGHVDLVMVIDGSKSVRPQNFELVKQFVNRIVDLLEVS
PHGTRVGLVQYSSRVRTEFPL
Download sequence
Identical sequences H0ZWH1
ENSTGUP00000014972 59729.ENSTGUP00000014972 ENSTGUP00000014972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]