SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014987 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014987
Domain Number 1 Region: 10-236
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-72
Family Lectin leg-like 0.00000000847
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000014987
Domain Number - Region: 257-375
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0144
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014987   Gene: ENSTGUG00000014591   Transcript: ENSTGUT00000015213
Sequence length 466
Comment pep:known_by_projection chromosome:taeGut3.2.4:3_random:680381:689460:-1 gene:ENSTGUG00000014591 transcript:ENSTGUT00000015213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATEGAAAAPHRRFEYKYSFKGPHLVQADGTVPFWVHTGNAIPSADQIRITTSLKSQKGSV
WTKTKSIFEYWEVEVTFRVTGRGRIGADGLAIWFTEEQGLEGPVFGAADKWNGVGIFFDS
FDNDGKKNNPGVIVVGNNGKLLYDHQNDGSTQALASCQRDFRNKPYPVRVKITYYQKTLT
VLINNGFTPDKEDYEFCAKVEDMVLPSQGYFGISAATGGLADDHDVLSFLTFQLTEPGKE
APTPDAEIPQKDKDKYREEFEHFQQELDKKKEEFQREHPDVQGQPGNYDAFETVSDRELR
QIFEGQNRIHLEIKQLNRQLDMILDEQRKYVSAVTEEIAKRGAGFPGQQGQVSQQEIETV
VKTQEEVIRQVKEIRSSVTDALRSISGAQHPGSAGVYETTQHFNDIKEHLHIVKRDIEHL
VQRNTPSTEKQKCPELPPFPSCLSTVHFFIFVAVQTVLFIGYVMYR
Download sequence
Identical sequences H0ZWI6
ENSTGUP00000014987 59729.ENSTGUP00000014987 ENSTGUP00000014987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]