SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015036 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015036
Domain Number 1 Region: 442-547
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-29
Family Cadherin 0.0007
Further Details:      
 
Domain Number 2 Region: 543-662
Classification Level Classification E-value
Superfamily Cadherin-like 4e-28
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 211-331
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 104-215
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-23
Family Cadherin 0.0029
Further Details:      
 
Domain Number 5 Region: 652-755
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-19
Family Cadherin 0.0021
Further Details:      
 
Domain Number 6 Region: 344-442
Classification Level Classification E-value
Superfamily Cadherin-like 1.19e-18
Family Cadherin 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000015036
Domain Number - Region: 4-90
Classification Level Classification E-value
Superfamily Cadherin-like 0.000214
Family Cadherin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015036   Gene: ENSTGUG00000014668   Transcript: ENSTGUT00000015264
Sequence length 1001
Comment pep:known_by_projection chromosome:taeGut3.2.4:13_random:104032:108907:1 gene:ENSTGUG00000014668 transcript:ENSTGUT00000015264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRAVYKVQEEQPPNSLIGSLASDYGLPDMGHLYKLEVGAPYLRVDGKTGDIYTTETSIDR
ESLRECQHLLPGEPCFLEFEVSITNLNANSSPRLLEGQIEVLDINDNTPNFASPVLTLSI
PENTNVGTLFPIPLAMDRDSGPNGVASYELMAGPEAQELFGLQVAEDQDEKQPQLIVMGN
LDREQWDSYDLTIKVQDGGNPPRASSALLRITILDMNDNAPKFEKALYEAELSENSPVGH
SVLQVKANDSDQGANAEIDYSFHQASDMVRRLLRLDRATGLITVQGPIDREDIGTLKFSV
MAKDKGANPKSARTQVVVTIKDMNDNAPSIEIRGIGLVTHQDGMANISEDVPVETAVALV
QVSDRDEGENAVVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYESVKEYTIEIV
AVDSGNPPLSSTNSLKVQVMDVNDNAPVFSQSFTEVAFPENNEPDELVMEVSATDADSGS
NAKLVYSLVTDPSSKGSFTIDPDSGEIRVKAVLDREQRERYEFLVVAEDKGSPSKQGTAS
VAINVMDRNDNDPKFMLSGYNFSVMENMPPLSPVGMVTVIDADKGENARIQLSVEQDNGD
FVIQNGTGTILSSISFDREQQSTYTFRLKAVDGGDPPRSAYVGVTINVLDENDNAPFITS
PSNATYKHILPHTSPGQQVSKVKAEDIDSGINAELIYSITGGNPFELFQISPQSGDITLE
KEILRKHHGLHRLVVRVNDKGKPSRHGTALVHFYVNETLANRTLLDTLVLVLFLDTPLDI
DIAGDPEYERSKQRSNILFGVIAGIVAVTLVIVLVVLVRYCRQREAKSGYQAGKKETKDL
YAPKQASKSGKSKNKVKKSKSPKPPKPTEDEEETGLQKSLKFNLMNDSVSDSPRIHLPLN
YPPGSPDLGRHYRSNSPLPSIQLQPQSPSASKKHQVVQDLPATNTFVGTGDNNSTGSEQY
SDYSYRTNPQKYTNKQVGELILRPAAAPPLHRGAIWTEVWE
Download sequence
Identical sequences H0ZWN5
59729.ENSTGUP00000015036 ENSTGUP00000015036 ENSTGUP00000015036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]