SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015044 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015044
Domain Number 1 Region: 8-195
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.95e-44
Family Prokaryotic proteases 0.000000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015044   Gene: ENSTGUG00000014680   Transcript: ENSTGUT00000015272
Sequence length 200
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:35451542:35455606:1 gene:ENSTGUG00000014680 transcript:ENSTGUT00000015272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHPFLGREVPISNGSGFVVSPDGLIVTNAHVVANRRRVRVKLASGDTYDAVVQDVDQVAD
IATIKIKPKVSGVTSVGTAGGGPSRCPQHPLPTLPLGRSAEVRQGEFVVAMGSPFALQNT
ITSGIVSSAQRGSRELGLAATDMEYIQTDAAIDVWNSGGPLVTWMVRWIGVNTMKVTSGI
SFAIPSDRLRKFLQKEEHRK
Download sequence
Identical sequences H0ZWP3
ENSTGUP00000015044 ENSTGUP00000015044 59729.ENSTGUP00000015044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]