SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015074 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015074
Domain Number 1 Region: 202-330
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-30
Family Cadherin 0.00054
Further Details:      
 
Domain Number 2 Region: 414-540
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-27
Family Cadherin 0.0025
Further Details:      
 
Domain Number 3 Region: 99-206
Classification Level Classification E-value
Superfamily Cadherin-like 6e-23
Family Cadherin 0.0033
Further Details:      
 
Domain Number 4 Region: 315-418
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-22
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 530-639
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000857
Family Cadherin 0.0029
Further Details:      
 
Domain Number 6 Region: 3-69
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000128
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015074   Gene: ENSTGUG00000014712   Transcript: ENSTGUT00000015303
Sequence length 688
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:149171720:149173783:1 gene:ENSTGUG00000014712 transcript:ENSTGUT00000015303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQIVYSIAEETERGAFVGNIAKDLGIDAATLSARKFRMITGSSKQYFNINASTGALSVNE
PIDREQLCELKSVCLLNYELVLENPLELYRMEFKVLDINDNSPSFPLSEYHINMPEFLSP
GARFTLPNAQDLDEGANSVQNYTLSLDEHFYLEMQIRGDGSKYPELVLKKALDREQQATH
RLLLTAKDGGNPPKSGDVPVIVTVLDTNDNAPEFEHSVYRASILENSPSGTLVVQVHATD
LDEGPNGEVRYSFSNTTSADLQRMFSIHPHTGEVTVNGVLAVQRPLLEMLIEARDNGAFG
MSSTAKLLVEITDVNNHGPEITITSLSSPIPEDAIPGTVIALLSILDKDPGENGKVTCQI
SENLPFQLKPSLQNYYSLVTSEVLDRELISEYNITITATDLGSPPLTTQKTVWVQISDVN
DNPPFFSAGAFDVFVEENNPLGAFLYQVSASDPDIGENGRVSYTLRNSTVAGSALTSFLS
MNLANGSIYAKRAFDFEQLRSFHFQVEAKDNGSPTLSAAITVNVYISDQNDNAPAILYPT
SQNGSVAVEVVPRLADEDYLVTKVVADDEDNAQNAWLSYHLAHSSDSTLFQLSPHTGELR
TTRSMRSTDFLKHKVVVVVRDHGDPPLSSTVTVGILLADTLPQALPDFDDSGEPPPLLNT
TNIYLIVSLACVSFIFAAFIFFLAIIRL
Download sequence
Identical sequences H0ZWS3
ENSTGUP00000015074 59729.ENSTGUP00000015074 ENSTGUP00000015074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]