SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015122 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015122
Domain Number 1 Region: 6-143
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.72e-45
Family Eukaryotic proteases 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015122   Gene: ENSTGUG00000014763   Transcript: ENSTGUT00000015357
Sequence length 143
Comment pep:novel chromosome:taeGut3.2.4:Un:96713753:96714477:1 gene:ENSTGUG00000014763 transcript:ENSTGUT00000015357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAYDYGMTRIVGGIGAAEAEWPWIVSIQHPWVPGLGHWCGGSLITADWVLTAAHCFDKFD
NISLLYVVIGATQLTQPGPGAQVRSVKKVVIHSDYRRSDYSYDIALMQLDRPVLCSSYIQ
LACLAEPTLSVSALHNCWIAGWG
Download sequence
Identical sequences H0ZWX1
ENSTGUP00000015122 59729.ENSTGUP00000015122 ENSTGUP00000015122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]