SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015133 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015133
Domain Number 1 Region: 4-146
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000377
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 149-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000439
Family EGF-type module 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015133   Gene: ENSTGUG00000014776   Transcript: ENSTGUT00000015369
Sequence length 197
Comment pep:novel chromosome:taeGut3.2.4:Un:122937828:122943330:1 gene:ENSTGUG00000014776 transcript:ENSTGUT00000015369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATCGHGCKYGECMGPNKCKCFPGFTGKTCNQDLNECGLKPRPCEHRCMNTHGSYKCYCLN
GYMLMPDGTCASSRTCAMVNCQYGCEEVKGQVQCLCPSGGLQLGPNGRTCIDIDECSTGK
AVCSYNRRCVNTFGSFYCKCQLGYELKYTSGRYNCVDVNECVTNRHRCNLHAECLNTQGS
FQCKCKQGYRGSGFDCA
Download sequence
Identical sequences H0ZWY2
ENSTGUP00000015133 ENSTGUP00000015133 59729.ENSTGUP00000015133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]