SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015169 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015169
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000338
Family Ubiquitin-related 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015169   Gene: ENSTGUG00000014816   Transcript: ENSTGUT00000015410
Sequence length 133
Comment pep:known chromosome:taeGut3.2.4:Un:9475264:9475945:1 gene:ENSTGUG00000014816 transcript:ENSTGUT00000015410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLFIRGQTLLTLELSGSETLAQIKERVAELSGIPPEEQLLLHAGTPLDDEAVLGQSPLP
EFTTLDLSTRLLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVV
PTFGKKKGPNANS
Download sequence
Identical sequences H0ZX18
ENSTGUP00000015169 XP_002186898.1.42559 XP_012432393.1.42559 ENSTGUP00000015169 59729.ENSTGUP00000015169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]