SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015174 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015174
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily PX domain 7.85e-18
Family PX domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000015174
Domain Number - Region: 90-185
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00176
Family Ubiquitin-related 0.082
Further Details:      
 
Domain Number - Region: 190-248
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00864
Family Second domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015174   Gene: ENSTGUG00000014787   Transcript: ENSTGUT00000015415
Sequence length 450
Comment pep:known_by_projection chromosome:taeGut3.2.4:3_random:488634:494848:1 gene:ENSTGUG00000014787 transcript:ENSTGUT00000015415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVVPAFPPKKIFTLTPAEVEQRREQLEK
YMQAVRQDPTLGGSETFNSFLRKAQQETQQIPTEEVVLEVLLSNGQKVKVTILTSDQTED
VLEAVASKLDLPDDLVGYFSLFLVRETKDGAFSFVRKLQEFELPYVSVTSLHNPEFQIIL
RKSYWDSAYDDDVMEHRVGLNLLYAQTVSDIEHGWILVNKEQHRQLKSLQEKVSKKEFIR
LAQTLKYYGYLKFDPCVTDFPEKGCHVVVSAGNNELNFQVRLPNEQIKEGSFKVTRMRCW
RVTSSVPMNNGPSGSSPGKSEVKLELAFEYLMSKDRLQWVTITSPQAIMLSICLQSMVDE
LMVKKSGGSIRKMFRRRVNGALRRSDSQQAVKSPPLLDSPDASWEPMDKLSSKITSVSLR
GISHSSSANDVGANDFHGNYAFEGIGDEDL
Download sequence
Identical sequences H0ZX23
ENSTGUP00000015174 ENSTGUP00000015174 59729.ENSTGUP00000015174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]