SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015302 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015302
Domain Number 1 Region: 121-274
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.18e-45
Family Eukaryotic proteases 0.00000721
Further Details:      
 
Domain Number 2 Region: 31-96
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000379
Family Scavenger receptor cysteine-rich (SRCR) domain 0.018
Further Details:      
 
Domain Number 3 Region: 1-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015302   Gene: ENSTGUG00000014950   Transcript: ENSTGUT00000015552
Sequence length 275
Comment pep:novel chromosome:taeGut3.2.4:Un:99512970:99525606:1 gene:ENSTGUG00000014950 transcript:ENSTGUT00000015552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRVDEHHCGSGKCIPLHNLRDNIPQCEDGSDEAKCMRLLNGSLITEGLVQARVGKMWHLA
CADDWSGEIADSVCQLLGLGDANMSSAVLFTGDGPFVTITKGGKHSLIFTKRWVQFYKAL
FFTRKLTTCGKHLSTQNNGTRIIGGNDARKEAWPWIVSLHFNFQPVCGASLVSDEWLVTA
AHCVYGRQLKPSRWRAVLGLYSQSDLAQPPAAVRNIDRIIINPHYMKQTKDSDIALMHLQ
HKVQYTDYIQPICLPEKNQQFLPGIKCSIAGWGNI
Download sequence
Identical sequences H0ZXF1
ENSTGUP00000015302 59729.ENSTGUP00000015302 ENSTGUP00000015302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]