SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015311 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015311
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily L domain-like 0.000000408
Family Ngr ectodomain-like 0.089
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000015311
Domain Number - Region: 80-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00573
Family EGF-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015311   Gene: ENSTGUG00000014949   Transcript: ENSTGUT00000015561
Sequence length 156
Comment pep:known_by_projection chromosome:taeGut3.2.4:3_random:428351:432202:1 gene:ENSTGUG00000014949 transcript:ENSTGUT00000015561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDLSNCSLHSVPPGLAEATTAMVLDLTENPLTALPSGSFLGFIHLQSLAVPLTLQCPGGR
DAWQNVTVDRSSRLCQGQRNPCNSSVELAWPCPENSVCAPDGPGLIQCLCDSPFHGYKCL
REGPFPMLLFGGILGTVTVSLSLLLWRTQRRKAKTP
Download sequence
Identical sequences H0ZXG0
ENSTGUP00000015311 ENSTGUP00000015311 59729.ENSTGUP00000015311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]