SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015313 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015313
Domain Number 1 Region: 156-260
Classification Level Classification E-value
Superfamily Immunoglobulin 1.86e-20
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 39-125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000518
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 3 Region: 115-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000377
Family Ovomucoid domain III-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015313   Gene: ENSTGUG00000014961   Transcript: ENSTGUT00000015563
Sequence length 298
Comment pep:known chromosome:taeGut3.2.4:13_random:1709885:1718980:-1 gene:ENSTGUG00000014961 transcript:ENSTGUT00000015563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKMKYRMVTAVLVALVQVSENFPALYHQGWWRLLREGDSCGKCDLALCSEPKDCPAGTVL
DRCGCCLECGNVEGQICDLDQGNHFYGQCGDHLECRLDADAARFGEVPEPQCVCKSQEII
CGPNGKTYENICQFNKDYSAKRNISMKHKGPCESAPVISMPPQDAQNYTGNDVIFGCEVS
AYPMPQLEWKKKGNKMFLPGDDTHVSVQARGGPQKYGVTGWLQIQGLKKSDEGIYICHTK
NKHGATYASARLKVIDVPSPAFAFTAGSRSASYSIEYEEYYDNSDEDDEEYESGNYDN
Download sequence
Identical sequences H0ZXG2
ENSTGUP00000015313 59729.ENSTGUP00000015313 ENSTGUP00000015313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]