SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015328 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015328
Domain Number 1 Region: 3-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.9e-21
Family Ubiquitin-related 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015328   Gene: ENSTGUG00000014979   Transcript: ENSTGUT00000015579
Sequence length 78
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:68720541:68721691:-1 gene:ENSTGUG00000014979 transcript:ENSTGUT00000015579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTVTLKTLQQQTFKIRMEPHETVRALKEKIEAEKGSEAFPVAGQKLIYAGKILSDDVP
IREYRIDEKNFVVVMVTK
Download sequence
Identical sequences H0ZXH7
ENSTGUP00000015328 ENSTGUP00000015328 XP_012431482.1.42559 59729.ENSTGUP00000015328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]