SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015329 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015329
Domain Number 1 Region: 1-98,126-148
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-33
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015329   Gene: ENSTGUG00000014976   Transcript: ENSTGUT00000015580
Sequence length 149
Comment pep:novel chromosome:taeGut3.2.4:Un:124922975:124924213:1 gene:ENSTGUG00000014976 transcript:ENSTGUT00000015580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGNTCYCNSVLQALYFCRPFREKVLAYKVQPRKKESLLTCLSDLFNSIATQKKKVGVIPP
KKFISRLRKENELFDNYMQQDAHEFLNYLLNTIADLLQEEKKQEKQNGKLQNGSIESEEG
DKPDLTWVHEIFQGTLTNETRCLNCEAVR
Download sequence
Identical sequences H0ZXH8
59729.ENSTGUP00000015329 ENSTGUP00000015329 ENSTGUP00000015329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]