SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015340 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015340
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-38
Family Calnexin/calreticulin 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015340   Gene: ENSTGUG00000014982   Transcript: ENSTGUT00000015593
Sequence length 134
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:68722353:68723492:-1 gene:ENSTGUG00000014982 transcript:ENSTGUT00000015593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWTRRWVESKHKPDYGRFVLTAGKFYGDAEKDKGIQTSQDARFYALSSRFEPFSNRDKTL
VVQFTVKHEQNIDCGGGYVKLFPASLSQEDMHGDSEYNIMFGPDICGPGTKKVHVIFNYK
GKNVLINKDIRCQV
Download sequence
Identical sequences H0ZXI9
ENSTGUP00000015340 59729.ENSTGUP00000015340 ENSTGUP00000015340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]