SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015450 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015450
Domain Number 1 Region: 115-176
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000168
Family UBA domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015450   Gene: ENSTGUG00000015096   Transcript: ENSTGUT00000015708
Sequence length 218
Comment pep:novel chromosome:taeGut3.2.4:Un:151270885:151274249:1 gene:ENSTGUG00000015096 transcript:ENSTGUT00000015708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQSLAKHNRSNIGTEGGPPPFVPFGQKCASYVQVDSRDLDRRKTLQMTNAVKPVADNDE
FEKQRTAAIAEVAKSKETKTFGGGGGSSRSNLSVSTGGNRNRELFQKEKIAKPEGKNEGV
YRELVDEKALKHITEMGFSKEAARQALMDNSNSLEAALNFLLNNSKQKPIQGPPPRGKGK
GRGRIRPEDEEELGNARPSAPSTLFDFLESKMGTLTVE
Download sequence
Identical sequences H0ZXU8
ENSTGUP00000015450 ENSTGUP00000015450 59729.ENSTGUP00000015450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]