SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015462 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015462
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000205
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 2 Region: 72-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015462   Gene: ENSTGUG00000015117   Transcript: ENSTGUT00000015723
Sequence length 114
Comment pep:novel chromosome:taeGut3.2.4:Un:151890340:151895984:1 gene:ENSTGUG00000015117 transcript:ENSTGUT00000015723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACNCHGHATDCFYDADVDQQRASLNIHGHYEGGGVCINCQHNTAGINCEKCAKGYYRPYG
VPVRAPDGCIPCSCNLEHADGCEEGSGRCFCKQNFQGDHCERCADGFYGYPFCV
Download sequence
Identical sequences H0ZXW0
59729.ENSTGUP00000015462 ENSTGUP00000015462 ENSTGUP00000015462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]