SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015484 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015484
Domain Number 1 Region: 638-815
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.03e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 222-338
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.22e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.00075
Further Details:      
 
Domain Number 3 Region: 17-108
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-23
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 
Domain Number 4 Region: 127-215
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000604
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 5 Region: 529-638
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000708
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Domain Number 6 Region: 899-1023
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000315
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 7 Region: 398-513
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000521
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 8 Region: 842-916
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000331
Family Ras-binding domain, RBD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015484   Gene: ENSTGUG00000015074   Transcript: ENSTGUT00000015745
Sequence length 1026
Comment pep:known_by_projection chromosome:taeGut3.2.4:13_random:2209750:2221408:-1 gene:ENSTGUG00000015074 transcript:ENSTGUT00000015745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDLTISPYASFTSLCEPRPTMLSGWLDKLSPQGNYFQRRYVRFDGKNLMYFSSEKEPYPK
GVIPLSVIEMARSTKDNKFQVITSHRIFVFRAENEAQRNEWCSTLQKKVMEQRLVGSRPR
PANTAHCQKSGTLELKGQKSKVFAALSLPEMWLYKSEQFFKMGIAMCFIEMRGSTIREAK
SRSFELITPSKTFSFVAESEREKREWMEALQEAIAEMLYDYEVAEKIWSNKANKYCADCW
AQSPDWASINLCVVICKQCAGQHRSLGSNVSKVQSLKLDTSVWNEIVQLFIVLGNDRANR
FWAARLPAAEAIAPDSGAEQRRDFITRKYREGRYRLPHPCYASQEEVLQALCTAVAGPAL
LKTILQFFSSSEAAVASDPAASEAAPGADLCPRARDPGPEGVYNEITQPVAHSGYLYRAT
APPKLPGARKSKEDFQRTWCSLERALLFFETEKCTEPLGHIDSGDLLSLGTLTSPSPTER
FRFTLELFLTGEKVQQLGTDGPETLQAWASAIGKWFTPVSCHCLLGYEFQRVGQLRYKCM
LNPERWQRAFFILQKSHLFICPAEEDGAEDSINLRRLQELSLVPPMDTPEKKELLVLVEM
GRTFYLQGLSRADSAAWYGDIQASAGGRGNALRDQQLSRGDIPIIVDSCIAFITQYAFFT
KGIYRKNGAKSRIKVLMEEFRRDARNVKLRISDNFIEDVTDVLKRFFRELEDPIFTLELH
PQWKEAAEISSKPQRLERYKELIHRLPRLNHKTLAALIGHLYRVQKCADLNQMSTKNLSL
LFAPSLFQTDGKGEHEVKVMEDLIDNYVSIFNIDEDQVSQMDLENSLITTWKDTQLSQAG
DLIIEVYLEQKVPDCCVTLKVSPSMTAEELTNQVLEMRNVAASLDIWLTFEALENGELER
PLHPKEKVLEQALQWCKLPEPSAAYLLVRKVPIGEGSCLFTGAKRETPKCGLLKCREEPP
KLLGNKFQERYFVLQDRRLLLLKEKRSAKPEREWPLDAAKVYMGIRKKLKPPAQWGFTLT
LDKQQL
Download sequence
Identical sequences H0ZXY2
ENSTGUP00000015484 59729.ENSTGUP00000015484 ENSTGUP00000015484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]