SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015486 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000015486
Domain Number - Region: 58-104
Classification Level Classification E-value
Superfamily Cadherin-like 0.0439
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015486   Gene: ENSTGUG00000015139   Transcript: ENSTGUT00000015747
Sequence length 115
Comment pep:novel chromosome:taeGut3.2.4:Un:126199311:126201259:-1 gene:ENSTGUG00000015139 transcript:ENSTGUT00000015747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSTRPEVASIEPLGPAGCLCSQRALVQRLTTIISAEDTLTGQVLRCDAIVDLIHGIQVVS
TMRELYLEDSLLELKIHALDSEGNTFSTLAGLVFDWTLVKDPEPDGFSDSHNTLR
Download sequence
Identical sequences H0ZXY4
59729.ENSTGUP00000015486 ENSTGUP00000015486 ENSTGUP00000015486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]