SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015507 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015507
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-41
Family Eukaryotic proteases 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015507   Gene: ENSTGUG00000015165   Transcript: ENSTGUT00000015769
Sequence length 138
Comment pep:novel chromosome:taeGut3.2.4:Un:126276543:126278098:-1 gene:ENSTGUG00000015165 transcript:ENSTGUT00000015769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRYSVPMGWRAYMGSHTINEKSNRVAMRSITRIIVHPQYDQSISDYDIALLEMETPVLFS
ELVQPICLPSTSRVFLYGTVCYVTGWGAVKENSHLAKTLQEARVRMINQSVCSKLYDDLI
TSRMLCAGNLNGGVDACQ
Download sequence
Identical sequences H0ZY05
ENSTGUP00000015507 ENSTGUP00000015507 59729.ENSTGUP00000015507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]