SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015533 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015533
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000167
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015533   Gene: ENSTGUG00000015191   Transcript: ENSTGUT00000015798
Sequence length 94
Comment pep:novel chromosome:taeGut3.2.4:Un:70679765:70680695:-1 gene:ENSTGUG00000015191 transcript:ENSTGUT00000015798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRIENCDSCFSRDFCTKCKSGFYSHRGRCFRGCPAGFAALEELMECVEGCEVGQWSEWGT
CSRNNKTCGFKWGLETRTRQIVKKPAKDTIPCPT
Download sequence
Identical sequences H0ZY31
59729.ENSTGUP00000015533 ENSTGUP00000015533 ENSTGUP00000015533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]