SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015538 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015538
Domain Number 1 Region: 12-209
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.96e-35
Family Prokaryotic proteases 0.00000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015538   Gene: ENSTGUG00000015192   Transcript: ENSTGUT00000015803
Sequence length 217
Comment pep:known_by_projection chromosome:taeGut3.2.4:4_random:25307:31201:1 gene:ENSTGUG00000015192 transcript:ENSTGUT00000015803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSSSPRYKFNFIADVVEKIAPAVVHIELFLRHAFSTQSALGLHDLLDLVSSFMPLSSCKV
LSSPFSITGPLPSQVRLPNVHSYDPTIKNFGNKSDICIKIHPKKKLPVLLLGHSADLRPG
EFVVAIGSPFALQNTVTTGIVSTAQRDGKELGLRDSDMDYIQTDAIINYGNSGGPLVNLD
GEVIGINTLKVTAGISFAIPSDRITQFLTESHDKQSK
Download sequence
Identical sequences H0ZY36
ENSTGUP00000015538 59729.ENSTGUP00000015538 ENSTGUP00000015538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]