SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015639 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015639
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily Cupredoxins 5.84e-43
Family Ephrin ectodomain 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015639   Gene: ENSTGUG00000015295   Transcript: ENSTGUT00000015906
Sequence length 184
Comment pep:novel chromosome:taeGut3.2.4:Un:41358078:41359790:1 gene:ENSTGUG00000015295 transcript:ENSTGUT00000015906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRREGYTVQVNVNDYLDIYCPHYNASVPEHRLEQYVLYMVNAEGYRTCNTSQGFKRWECN
RPHAPHSPIKFSEKFQRYSAFSLGYEFRAGQEYYYISTPTHNHHRACLKMKVFVCCSSTS
HSGEKLAPTLPQFTLRPEVKIEDLENFNPEMPKLEKSISGTSPKREHLPLAVAAALFLMT
LLAS
Download sequence
Identical sequences H0ZYD6
ENSTGUP00000015639 59729.ENSTGUP00000015639 ENSTGUP00000015639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]