SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015640 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015640
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000502
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 118-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015640   Gene: ENSTGUG00000015293   Transcript: ENSTGUT00000015907
Sequence length 181
Comment pep:novel chromosome:taeGut3.2.4:Un:12877767:12886276:1 gene:ENSTGUG00000015293 transcript:ENSTGUT00000015907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLNECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGTCSNALSCLMANCQYGCDVLKGE
VRCRCPSPGLQLGPDGRTCVDIDECATGRVLCPRFRHCVNTFGSYICRCHKGFDLMYIGG
KYQCHDIDECSLGHHQCGSFSHCYNTPGSYKCICKEGYRDNGTNCMLIPIVLIEPRGPYH
I
Download sequence
Identical sequences H0ZYD7
ENSTGUP00000015640 ENSTGUP00000015640 59729.ENSTGUP00000015640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]