SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015674 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015674
Domain Number 1 Region: 276-561
Classification Level Classification E-value
Superfamily Kelch motif 4.97e-45
Family Kelch motif 0.008
Further Details:      
 
Domain Number 2 Region: 45-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-23
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 3 Region: 696-842
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-23
Family C-type lectin domain 0.0037
Further Details:      
 
Domain Number 4 Region: 976-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000015674
Domain Number - Region: 13-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 162-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0733
Family EGF-type module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015674   Gene: ENSTGUG00000015245   Transcript: ENSTGUT00000015944
Sequence length 1342
Comment pep:known_by_projection chromosome:taeGut3.2.4:4_random:3607843:3752375:1 gene:ENSTGUG00000015245 transcript:ENSTGUT00000015944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAGEEVAVSKECDKPCANGGRCQPGTGQCECQPGWVGDQCQHCGGRFRLTEPSGYVTD
GPGNYKYKTKCTWLIEGRPNTVLRLRFNHFATECSWDHLYVYDGDSIYAPLLAAFSGLIV
PEKDSNETVPEVVATSGYALLHFFSDAAYNLTGFNITYNFNVCPNNCSGQGECRLNSSTM
APQCECTERWKGEACDIPYCPGDCGAPERGHCSLNGSKACVCSAGWQGPDCSIHLPANQS
FWTREEYTLPKLARASHKAVIHDNKMWIVGGYVFNHSDSQKVLAYDLVSEEWLPLNSSVN
SVEMRYGHSLALHKDNIYMYGGKLDATGNVSSQLWVFHIPRQSWAVLAPRAKEQYAVVGH
SAHMVTLRDNSTVMLVLFGHCPLYGYISNVQEYNLVTNTWSILQTSGALVQGGYGHSSVY
DPNTRSIYIHGGYKAFSANKYRLADDLYKYEVDSRMWTILKDSRFFRYLHTAVIVSGTML
VFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPRPALHHDVNRFGHSAVLYNSTMY
VFGGFNSLLLSDILKFTPERCEAFGNETSCLGAGPGVRCVWAPHPPRCIPWENATLQQQQ
KVFEDCPPKPVVDNEKCDQITDCYSCTANTNSCQWCSDQCVPAHNNCTEEQVPVTLYDNC
PKDNPAYYCNKKTSCKSCAMDQNCQWEPRNQECIALPENICGTNWHLVGNSCLKITNAKE
NYDHAKLSCRSNGALLASLTTQKKVEFVLKELQKIQSSRSLSPKTLTPWVGLRKINVSYW
CWEDMSPFTNTLVQWLPDEPSDAGFCGYLAEPSQQGLKAATCINEVNGTVCERPANHSAK
QCRTPCALRAACAECTSGSSECMWCSNMQQCVDSNAYVASFPYGQCMEWYTMSSCPPENC
SGYCTCAQCLEQPGCGWCTDPSNTGKGKCIEGSYRGPVRMPTPSTPGRHSLEPVLNVSMC
PVESSYNWSFIQCPACQCNGHSKCVNESICEKCENLTTGRHCETCISGYYGDPTNGGTCQ
PCKCNGHASVCNTNTGKCFCTTKGIKGDECQLCEVENRYQGNPLKGTCYYTLLIDYQFTF
SLSQEDDRYYTAINFVATPEEQNRDLDMFINASKNFNLNITWSTSFAAGTQAGEEIPVVS
RTNIKEYKDSFSNEKFDFRNNLNITFFVYVSNFTWPIKIQIAFSQHSNFMDLVQFFVTFF
SCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFASINVALETDEEPPDLIGG
SIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGIPPPGQSGLAVASALVDISQQMPIAY
KEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences H0ZYH1
59729.ENSTGUP00000015674 ENSTGUP00000015674 ENSTGUP00000015674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]