SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015762 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015762
Domain Number 1 Region: 20-57
Classification Level Classification E-value
Superfamily UBA-like 0.0000000112
Family UBA domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015762   Gene: ENSTGUG00000015427   Transcript: ENSTGUT00000016038
Sequence length 57
Comment pep:novel chromosome:taeGut3.2.4:Un:127697706:127698391:-1 gene:ENSTGUG00000015427 transcript:ENSTGUT00000016038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSVGTTRARGSWEQTQTQSQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQV
Download sequence
Identical sequences A0A091I3L4 A0A093CNQ5 H0ZYQ9
59729.ENSTGUP00000015762 ENSTGUP00000015762 ENSTGUP00000015762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]